Lineage for d4cu8a4 (4cu8 A:758-865)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765186Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 2765204Protein Beta-galactosidase [419186] (1 species)
    Pfam PF16355
    inserted beta hairpin between strands 4 and 5 of canonical fold
  7. 2765205Species Streptococcus pneumoniae TIGR4 [TaxId:170187] [419697] (3 PDB entries)
  8. 2765207Domain d4cu8a4: 4cu8 A:758-865 [413728]
    Other proteins in same PDB: d4cu8a1, d4cu8a2, d4cu8a3, d4cu8a5
    automated match to d4cu6a5
    complexed with dgj, edo, so4

Details for d4cu8a4

PDB Entry: 4cu8 (more details), 2.5 Å

PDB Description: Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA
PDB Compounds: (A:) glycoside hydrolase 2

SCOPe Domain Sequences for d4cu8a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cu8a4 b.1.18.2 (A:758-865) Beta-galactosidase {Streptococcus pneumoniae TIGR4 [TaxId: 170187]}
kkpmvhllphwnwenkelaskvadsegkipvraysnassvelflngkslglktfnkkqts
dgrtyqegananelylewkvayqpgtleaiardesgkeiardkittag

SCOPe Domain Coordinates for d4cu8a4:

Click to download the PDB-style file with coordinates for d4cu8a4.
(The format of our PDB-style files is described here.)

Timeline for d4cu8a4:

  • d4cu8a4 is new in SCOPe 2.08-stable