Lineage for d4cu7a3 (4cu7 A:426-757)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830645Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 2830870Species Streptococcus pneumoniae TIGR4 [TaxId:170187] [419696] (3 PDB entries)
  8. 2830871Domain d4cu7a3: 4cu7 A:426-757 [413722]
    Other proteins in same PDB: d4cu7a1, d4cu7a2, d4cu7a4, d4cu7a5
    automated match to d4cu6a4
    complexed with edo, gif, so4

Details for d4cu7a3

PDB Entry: 4cu7 (more details), 2.2 Å

PDB Description: Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d4cu7a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cu7a3 c.1.8.3 (A:426-757) beta-Galactosidase, domain 3 {Streptococcus pneumoniae TIGR4 [TaxId: 170187]}
yyhwtpnegfslngerikfhgvslhhdhgalgaeenykaeyrrlkqmkemgvnsirtthn
paseqtlqiaaelgllvqeeafdtwyggkkpydygrffekdathpearkgekwsdfdlrt
mvergknnpaifmwsigneigeangdahslatvkrlvkvikdvdktryvtmgadkfrfgn
gsgghekiadeldavgfnysednykalrakhpkwliygsetssatrtrgsyyrperelkh
sngpernyeqsdygndrvgwgktataswtfdrdnagyagqfiwtgtdyigeptpwhnqnq
tpvkssyfgivdtagipkhdfylyqsqwvsvk

SCOPe Domain Coordinates for d4cu7a3:

Click to download the PDB-style file with coordinates for d4cu7a3.
(The format of our PDB-style files is described here.)

Timeline for d4cu7a3:

  • d4cu7a3 is new in SCOPe 2.08-stable