SCOP 1.71: Domain d1b8hb2: 1b8h B:111-228

Lineage for d1b8hb2 (1b8h B:111-228)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (2 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
   duplication: consists of two domains of this fold

6. Protein gp45 sliding clamp [55984] (2 species)

7. Species Bacteriophage RB69 [TaxId:12353] [55985] (2 PDB entries)

8. Domain d1b8hb2: 1b8h B:111-228 [41371]

Details for d1b8hb2

PDB Entry: 1b8h, 3 Å

PDB Description: sliding clamp, dna polymerase

SCOP Domain Sequences for d1b8hb2:

Sequence; same for both SEQRES and ATOM records:

>d1b8hb2 d.131.1.2 (B:111-228) gp45 sliding clamp {Bacteriophage RB69}
vasviteikaedlqqllrvsrglqidtiaitnkdgkivingynkvedsgltrpkysltlt
dydgsnnfnfvinmanmkiqpgnykvmlwgagdkvaakfessqvsyviameadsthdf

Timeline for d1b8hb2:

• d1b8hb2 first appeared (with stable ids) in SCOP 1.55
  
• d1b8hb2 appears in SCOP 1.69
  
• d1b8hb2 appears in SCOP 1.73
  
• d1b8hb2 appears in the current release, SCOPe 2.08