SCOPe 2.08: Domain d1b77c2: 1b77 C:111-228

Lineage for d1b77c2 (1b77 C:111-228)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein gp45 sliding clamp [55984] (2 species)

7. Species Bacteriophage RB69 [TaxId:12353] [55985] (2 PDB entries)

8. Domain d1b77c2: 1b77 C:111-228 [41367]
   protein/DNA complex

Details for d1b77c2

PDB Entry: 1b77, 2.1 Å

PDB Description: building a replisome structure from interacting pieces: a sliding clamp complexed with an interaction peptide from dna polymerase

PDB Compounds: (C:) protein (sliding clamp)

SCOPe Domain Sequences for d1b77c2:

Sequence; same for both SEQRES and ATOM records:

>d1b77c2 d.131.1.2 (C:111-228) gp45 sliding clamp {Bacteriophage RB69 [TaxId: 12353]}
vasviteikaedlqqllrvsrglqidtiaitnkdgkivingynkvedsgltrpkysltlt
dydgsnnfnfvinmanmkiqpgnykvmlwgagdkvaakfessqvsyviameadsthdf

Timeline for d1b77c2:

• d1b77c2 first appeared (with stable ids) in SCOP 1.55
  
• d1b77c2 appears in SCOPe 2.07