SCOPe 2.08: Domain d4b3ic1: 4b3i C:2-280

Lineage for d4b3ic1 (4b3i C:2-280)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [228163] (23 PDB entries)

8. Domain d4b3ic1: 4b3i C:2-280 [413665]
   automated match to d5xyja1
   complexed with adp, coa, gol, so4

Details for d4b3ic1

PDB Entry: 4b3i, 2.63 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis fatty acid beta- oxidation complex with CoenzymeA bound at the hydratase active sites

PDB Compounds: (C:) fatty acid beta-oxidation complex beta-chain fada

SCOPe Domain Sequences for d4b3ic1:

Sequence; same for both SEQRES and ATOM records:

>d4b3ic1 c.95.1.0 (C:2-280) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
seeafiyeairtprgkqkngslhevkplslvvglidelrkrhpdldenlisdvilgcvsp
vgdqggdiaraavlasgmpvtsggvqlnrfcasgleavntaaqkvrsgwddlvlaggves
msrvpmgsdggamgldpatnydvmfvpqsigadliatiegfsredvdayalrsqqkaaea
wsggyfaksvvpvrdqngllildhdehmrpdttkeglaklkpafeglaalggfddvalqk
yhwvekinhvhtggnssgivdgaalvmigsaaagklqgl

Timeline for d4b3ic1:

• d4b3ic1 is new in SCOPe 2.08-stable