Lineage for d4a2pa1 (4a2p A:246-456)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870939Protein automated matches [190301] (7 species)
    not a true protein
  7. 2870940Species Anas platyrhynchos [TaxId:8839] [419890] (1 PDB entry)
  8. 2870941Domain d4a2pa1: 4a2p A:246-456 [413634]
    automated match to d4a2wa1

Details for d4a2pa1

PDB Entry: 4a2p (more details), 3 Å

PDB Description: structure of duck rig-i helicase domain
PDB Compounds: (A:) retinoic acid inducible protein I

SCOPe Domain Sequences for d4a2pa1:

Sequence, based on SEQRES records: (download)

>d4a2pa1 c.37.1.19 (A:246-456) automated matches {Anas platyrhynchos [TaxId: 8839]}
arsyqielaqpaingknalicaptgsgktfvsilicehhfqnmpagrkakvvflatkvpv
yeqqknvfkhhferqgysvqgisgenfsnvsvekviedsdiivvtpqilvnsfedgtlts
lsiftlmifdechnttgnhpynvlmtryleqkfnsasqlpqilgltasvgvgnaknieet
iehicslcsyldiqaistvreniqelqrfmn

Sequence, based on observed residues (ATOM records): (download)

>d4a2pa1 c.37.1.19 (A:246-456) automated matches {Anas platyrhynchos [TaxId: 8839]}
arsyqielaqpaingknalicaptgsgktfvsilicehhfqnmpagrkakvvflatkvpv
yeqqknvfkhhferqgysvqgisgesvekviedsdiivvtpqilvnsfedgtltslsift
lmifdechnttgnhpynvlmtryleqkfnslpqilgltasvgvgnaknieetiehicslc
syldiqaistvreniqelqrfmn

SCOPe Domain Coordinates for d4a2pa1:

Click to download the PDB-style file with coordinates for d4a2pa1.
(The format of our PDB-style files is described here.)

Timeline for d4a2pa1:

  • d4a2pa1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4a2pa2