Lineage for d1b77a2 (1b77 A:111-228)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2539893Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2539894Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2540079Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2540080Protein gp45 sliding clamp [55984] (2 species)
  7. 2540081Species Bacteriophage RB69 [TaxId:12353] [55985] (2 PDB entries)
  8. 2540083Domain d1b77a2: 1b77 A:111-228 [41363]
    protein/DNA complex

Details for d1b77a2

PDB Entry: 1b77 (more details), 2.1 Å

PDB Description: building a replisome structure from interacting pieces: a sliding clamp complexed with an interaction peptide from dna polymerase
PDB Compounds: (A:) protein (sliding clamp)

SCOPe Domain Sequences for d1b77a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b77a2 d.131.1.2 (A:111-228) gp45 sliding clamp {Bacteriophage RB69 [TaxId: 12353]}
vasviteikaedlqqllrvsrglqidtiaitnkdgkivingynkvedsgltrpkysltlt
dydgsnnfnfvinmanmkiqpgnykvmlwgagdkvaakfessqvsyviameadsthdf

SCOPe Domain Coordinates for d1b77a2:

Click to download the PDB-style file with coordinates for d1b77a2.
(The format of our PDB-style files is described here.)

Timeline for d1b77a2: