Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein) duplication: consists of three domains of this fold |
Protein DNA polymerase III, beta subunit [55981] (2 species) |
Species Escherichia coli [TaxId:562] [55982] (30 PDB entries) Uniprot P00583 |
Domain d2polb2: 2pol B:123-244 [41360] |
PDB Entry: 2pol (more details), 2.5 Å
SCOPe Domain Sequences for d2polb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2polb2 d.131.1.1 (B:123-244) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]} qseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavcsm pigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgrfp dy
Timeline for d2polb2: