Lineage for d2polb2 (2pol B:123-244)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196753Fold d.131: DNA clamp [55978] (1 superfamily)
  4. 196754Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 196755Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
  6. 196756Protein DNA polymerase III, beta subunit [55981] (1 species)
  7. 196757Species Escherichia coli [TaxId:562] [55982] (3 PDB entries)
  8. 196762Domain d2polb2: 2pol B:123-244 [41360]

Details for d2polb2

PDB Entry: 2pol (more details), 2.5 Å

PDB Description: three-dimensional structure of the beta subunit of escherichia coli dna polymerase iii holoenzyme: a sliding dna clamp

SCOP Domain Sequences for d2polb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2polb2 d.131.1.1 (B:123-244) DNA polymerase III, beta subunit {Escherichia coli}
qseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavcsm
pigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgrfp
dy

SCOP Domain Coordinates for d2polb2:

Click to download the PDB-style file with coordinates for d2polb2.
(The format of our PDB-style files is described here.)

Timeline for d2polb2: