SCOP 1.57: Domain d2polb2: 2pol B:123-244

Lineage for d2polb2 (2pol B:123-244)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)

4. Superfamily d.131.1: DNA clamp [55979] (2 families)

5. Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)

6. Protein DNA polymerase III, beta subunit [55981] (1 species)

7. Species Escherichia coli [TaxId:562] [55982] (2 PDB entries)

8. Domain d2polb2: 2pol B:123-244 [41360]

Details for d2polb2

PDB Entry: 2pol, 2.5 Å

PDB Description: three-dimensional structure of the beta subunit of escherichia coli dna polymerase iii holoenzyme: a sliding dna clamp

SCOP Domain Sequences for d2polb2:

Sequence; same for both SEQRES and ATOM records:

>d2polb2 d.131.1.1 (B:123-244) DNA polymerase III, beta subunit {Escherichia coli}
qseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavcsm
pigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgrfp
dy

Timeline for d2polb2:

• d2polb2 first appeared (with stable ids) in SCOP 1.55
  
• d2polb2 appears in SCOP 1.59
  
• d2polb2 appears in the current release, SCOPe 2.08