Lineage for d3zkbh1 (3zkb H:12-213)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973995Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2973996Protein automated matches [226867] (22 species)
    not a true protein
  7. 2974114Species Mycobacterium tuberculosis [TaxId:1773] [419889] (2 PDB entries)
  8. 2974122Domain d3zkbh1: 3zkb H:12-213 [413599]
    Other proteins in same PDB: d3zkba2, d3zkbb2, d3zkbc2, d3zkbd2, d3zkbe2, d3zkbf2, d3zkbg2, d3zkbh2, d3zkbi2, d3zkbj2, d3zkbk2, d3zkbl2, d3zkbm2, d3zkbn2, d3zkbo2, d3zkbp2
    automated match to d6zt3a1
    complexed with anp, mg

Details for d3zkbh1

PDB Entry: 3zkb (more details), 2.9 Å

PDB Description: crystal structure of the atpase region of mycobacterium tuberculosis gyrb with amppnp
PDB Compounds: (H:) DNA gyrase subunit b

SCOPe Domain Sequences for d3zkbh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zkbh1 d.122.1.0 (H:12-213) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ygaasitilegleavrkrpgmyigstgerglhhliwevvdnavdeamagyattvnvvlle
dggvevaddgrgipvathasgiptvdvvmtqlhaggkfdsdayaisgglhgvgvsvvnal
strleveikrdgyewsqvyekseplglkqgaptkktgstvrfwadpavfetteydfetva
rrlqemaflnkgltinltderv

SCOPe Domain Coordinates for d3zkbh1:

Click to download the PDB-style file with coordinates for d3zkbh1.
(The format of our PDB-style files is described here.)

Timeline for d3zkbh1:

  • d3zkbh1 is new in SCOPe 2.08-stable