Lineage for d3zkbc2 (3zkb C:242-425)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2931088Species Mycobacterium tuberculosis [TaxId:1773] [224917] (3 PDB entries)
  8. 2931093Domain d3zkbc2: 3zkb C:242-425 [413590]
    Other proteins in same PDB: d3zkba1, d3zkbb1, d3zkbc1, d3zkbd1, d3zkbe1, d3zkbf1, d3zkbg1, d3zkbh1, d3zkbi1, d3zkbj1, d3zkbk1, d3zkbl1, d3zkbm1, d3zkbn1, d3zkbo1, d3zkbp1
    automated match to d6zt3a2
    complexed with anp, mg

Details for d3zkbc2

PDB Entry: 3zkb (more details), 2.9 Å

PDB Description: crystal structure of the atpase region of mycobacterium tuberculosis gyrb with amppnp
PDB Compounds: (C:) DNA gyrase subunit b

SCOPe Domain Sequences for d3zkbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zkbc2 d.14.1.0 (C:242-425) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
aphkvksrtfhypgglvdfvkhinrtknaihssivdfsgkgtgheveiamqwnagysesv
htfantintheggtheegfrsaltsvvnkyakdrkllkdkdpnltgddireglaavisvk
vsepqfegqtktklgntevksfvqkvcneqlthwfeanptdakvvvnkavssaqariaar
kare

SCOPe Domain Coordinates for d3zkbc2:

Click to download the PDB-style file with coordinates for d3zkbc2.
(The format of our PDB-style files is described here.)

Timeline for d3zkbc2:

  • d3zkbc2 is new in SCOPe 2.08-stable