SCOPe 2.06: Domain d2polb1: 2pol B:1-122

Lineage for d2polb1 (2pol B:1-122)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
   duplication: consists of three domains of this fold

6. Protein DNA polymerase III, beta subunit [55981] (2 species)

7. Species Escherichia coli [TaxId:562] [55982] (30 PDB entries)
   Uniprot P00583

8. Domain d2polb1: 2pol B:1-122 [41359]

Details for d2polb1

PDB Entry: 2pol, 2.5 Å

PDB Description: three-dimensional structure of the beta subunit of escherichia coli dna polymerase iii holoenzyme: a sliding dna clamp

PDB Compounds: (B:) DNA polymerase III (beta subunit)

SCOPe Domain Sequences for d2polb1:

Sequence; same for both SEQRES and ATOM records:

>d2polb1 d.131.1.1 (B:1-122) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]}
mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememvarvalv
qphepgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnld
dw

Timeline for d2polb1:

• d2polb1 first appeared (with stable ids) in SCOP 1.55
  
• d2polb1 appears in SCOPe 2.05
  
• d2polb1 appears in SCOPe 2.07
  
• d2polb1 appears in the current release, SCOPe 2.08