Lineage for d2pola2 (2pol A:123-244)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35898Fold d.131: DNA clamp [55978] (1 superfamily)
  4. 35899Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 35900Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
  6. 35901Protein DNA polymerase III, beta subunit [55981] (1 species)
  7. 35902Species Escherichia coli [TaxId:562] [55982] (1 PDB entry)
  8. 35904Domain d2pola2: 2pol A:123-244 [41357]

Details for d2pola2

PDB Entry: 2pol (more details), 2.5 Å

PDB Description: three-dimensional structure of the beta subunit of escherichia coli dna polymerase iii holoenzyme: a sliding dna clamp

SCOP Domain Sequences for d2pola2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pola2 d.131.1.1 (A:123-244) DNA polymerase III, beta subunit {Escherichia coli}
qseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavcsm
pigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgrfp
dy

SCOP Domain Coordinates for d2pola2:

Click to download the PDB-style file with coordinates for d2pola2.
(The format of our PDB-style files is described here.)

Timeline for d2pola2: