Lineage for d3x1ga2 (3x1g A:167-313)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strandsSuperfamily b.6.1: Cupredoxins [49503] (8 families) 
contains copper-binding site
Family b.6.1.0: automated matches [191502] (1 protein)
not a true familyProtein automated matches [190824] (31 species)
not a true protein
Species Geobacillus thermodenitrificans [TaxId:420246] [419887] (18 PDB entries) 
Domain d3x1ga2: 3x1g A:167-313 [413563]
automated match to d6thea2
complexed with acy, cu, mpd; mutant
Details for d3x1ga2
PDB Entry: 3x1g (more details), 1.3 Å
PDB Description: h294m mutant of copper-containing nitrite reductase from geobacillus thermodenitrificans showing two coordination geometries at the t2cu site
PDB Compounds: (A:) nitrite reductaseSCOPe Domain Sequences for d3x1ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3x1ga2 b.6.1.0 (A:167-313) automated matches {Geobacillus thermodenitrificans [TaxId: 420246]}
dreyvliqnewykyndmndfqngvpsyvvfsskalkpgdpntngdtftlkekpllakvge
kirlyinnvgpnevssfhvvgtvfddvyldgnpnnhlqgmqtvmlpasggavveftvtrp
gtypivtmqfnhaqkgavamlkvtetg
SCOPe Domain Coordinates for d3x1ga2:
Click to download the PDB-style file with coordinates for d3x1ga2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3x1ga2:
- d3x1ga2 is new in SCOPe 2.08-stable
View in 3D
