SCOPe 2.08: Domain d3x1ga1: 3x1g A:18-166

Lineage for d3x1ga1 (3x1g A:18-166)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Geobacillus thermodenitrificans [TaxId:420246] [419887] (18 PDB entries)

8. Domain d3x1ga1: 3x1g A:18-166 [413562]
   automated match to d6thea1
   complexed with acy, cu, mpd; mutant

Details for d3x1ga1

PDB Entry: 3x1g, 1.3 Å

PDB Description: h294m mutant of copper-containing nitrite reductase from geobacillus thermodenitrificans showing two coordination geometries at the t2cu site

PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d3x1ga1:

Sequence; same for both SEQRES and ATOM records:

>d3x1ga1 b.6.1.0 (A:18-166) automated matches {Geobacillus thermodenitrificans [TaxId: 420246]}
iaahkgvnqapvplkmervgphdvhiemtaqitdieidkgkiykawtfngqapgplvvvn
egdtihftlknmdpvvphsmdfhavhaspskdfidvmpnksgtftypankpgvfmyhcgt
kpvlqhiangmhgviivkpkngyptdkev

Timeline for d3x1ga1:

• d3x1ga1 is new in SCOPe 2.08-stable