![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (2 families) ![]() |
![]() | Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein) duplication: consists of three domains of this fold |
![]() | Protein DNA polymerase III, beta subunit [55981] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [55982] (5 PDB entries) |
![]() | Domain d2pola1: 2pol A:1-122 [41356] |
PDB Entry: 2pol (more details), 2.5 Å
SCOP Domain Sequences for d2pola1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pola1 d.131.1.1 (A:1-122) DNA polymerase III, beta subunit {Escherichia coli} mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememvarvalv qphepgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnld dw
Timeline for d2pola1: