SCOP 1.55: Domain d2pola1: 2pol A:1-122

Lineage for d2pola1 (2pol A:1-122)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)

4. Superfamily d.131.1: DNA clamp [55979] (2 families)

5. Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)

6. Protein DNA polymerase III, beta subunit [55981] (1 species)

7. Species Escherichia coli [TaxId:562] [55982] (1 PDB entry)

8. Domain d2pola1: 2pol A:1-122 [41356]

Details for d2pola1

PDB Entry: 2pol, 2.5 Å

PDB Description: three-dimensional structure of the beta subunit of escherichia coli dna polymerase iii holoenzyme: a sliding dna clamp

SCOP Domain Sequences for d2pola1:

Sequence; same for both SEQRES and ATOM records:

>d2pola1 d.131.1.1 (A:1-122) DNA polymerase III, beta subunit {Escherichia coli}
mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememvarvalv
qphepgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnld
dw

Timeline for d2pola1:

• d2pola1 appears in SCOP 1.57
  
• d2pola1 appears in the current release, SCOPe 2.08