Lineage for d1qm4b3 (1qm4 B:253-396)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976292Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2976293Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2976294Family d.130.1.1: S-adenosylmethionine synthetase [55974] (2 proteins)
  6. 2976295Protein S-adenosylmethionine synthetase [55975] (3 species)
    synonym: methionine adenosyltransferase, MAT
  7. 2976382Species Norway rat (Rattus norvegicus) [TaxId:10116] [55977] (5 PDB entries)
  8. 2976394Domain d1qm4b3: 1qm4 B:253-396 [41355]
    complexed with amb, k, mg, so4

Details for d1qm4b3

PDB Entry: 1qm4 (more details), 2.66 Å

PDB Description: methionine adenosyltransferase complexed with a l-methionine analogue
PDB Compounds: (B:) methionine adenosyltransferase, alpha form

SCOPe Domain Sequences for d1qm4b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qm4b3 d.130.1.1 (B:253-396) S-adenosylmethionine synthetase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
iggpqgdagvtgrkiivdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkaglc
rrvlvqvsyaigvaeplsisiftygtskkterellevvnknfdlrpgvivrdldlkkpiy
qktacyghfgrsefpwevpkklvf

SCOPe Domain Coordinates for d1qm4b3:

Click to download the PDB-style file with coordinates for d1qm4b3.
(The format of our PDB-style files is described here.)

Timeline for d1qm4b3: