Lineage for d1qm4b2 (1qm4 B:129-252)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196717Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
  4. 196718Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (1 family) (S)
  5. 196719Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)
  6. 196720Protein S-adenosylmethionine synthetase [55975] (2 species)
  7. 196746Species Rat (Rattus norvegicus) [TaxId:10116] [55977] (1 PDB entry)
  8. 196751Domain d1qm4b2: 1qm4 B:129-252 [41354]

Details for d1qm4b2

PDB Entry: 1qm4 (more details), 2.66 Å

PDB Description: methionine adenosyltransferase complexed with a l-methionine analogue

SCOP Domain Sequences for d1qm4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qm4b2 d.130.1.1 (B:129-252) S-adenosylmethionine synthetase {Rat (Rattus norvegicus)}
edvgagdqglmfgyatdeteecmpltivlahklntrmadlrrsgvlpwlrpdsktqvtvq
yvqdngavipvrvhtivisvqhneditleamrealkeqvikavvpakyldedtiyhlqps
grfv

SCOP Domain Coordinates for d1qm4b2:

Click to download the PDB-style file with coordinates for d1qm4b2.
(The format of our PDB-style files is described here.)

Timeline for d1qm4b2: