![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
![]() | Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) ![]() |
![]() | Family d.130.1.1: S-adenosylmethionine synthetase [55974] (2 proteins) |
![]() | Protein S-adenosylmethionine synthetase [55975] (3 species) synonym: methionine adenosyltransferase, MAT |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [55977] (5 PDB entries) |
![]() | Domain d1qm4b2: 1qm4 B:129-252 [41354] complexed with amb, k, mg, so4 |
PDB Entry: 1qm4 (more details), 2.66 Å
SCOPe Domain Sequences for d1qm4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qm4b2 d.130.1.1 (B:129-252) S-adenosylmethionine synthetase {Norway rat (Rattus norvegicus) [TaxId: 10116]} edvgagdqglmfgyatdeteecmpltivlahklntrmadlrrsgvlpwlrpdsktqvtvq yvqdngavipvrvhtivisvqhneditleamrealkeqvikavvpakyldedtiyhlqps grfv
Timeline for d1qm4b2: