Lineage for d1qm4b1 (1qm4 B:17-116)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215558Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2215559Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2215560Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)
  6. 2215561Protein S-adenosylmethionine synthetase [55975] (3 species)
    synonym: methionine adenosyltransferase, MAT
  7. 2215633Species Norway rat (Rattus norvegicus) [TaxId:10116] [55977] (5 PDB entries)
  8. 2215637Domain d1qm4b1: 1qm4 B:17-116 [41353]
    complexed with amb, k, mg, so4

Details for d1qm4b1

PDB Entry: 1qm4 (more details), 2.66 Å

PDB Description: methionine adenosyltransferase complexed with a l-methionine analogue
PDB Compounds: (B:) methionine adenosyltransferase, alpha form

SCOPe Domain Sequences for d1qm4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qm4b1 d.130.1.1 (B:17-116) S-adenosylmethionine synthetase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gafmftsesvgeghpdkicdqisdavldahlkqdpnakvacetvcktgmvllcgeitsma
midyqrvvrdtikhigyddsakgfdfktcnvlvaleqqsp

SCOPe Domain Coordinates for d1qm4b1:

Click to download the PDB-style file with coordinates for d1qm4b1.
(The format of our PDB-style files is described here.)

Timeline for d1qm4b1: