Lineage for d1qm4b1 (1qm4 B:17-116)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 137596Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
  4. 137597Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (1 family) (S)
  5. 137598Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)
  6. 137599Protein S-adenosylmethionine synthetase [55975] (2 species)
  7. 137625Species Rat (Rattus norvegicus) [TaxId:10116] [55977] (1 PDB entry)
  8. 137629Domain d1qm4b1: 1qm4 B:17-116 [41353]

Details for d1qm4b1

PDB Entry: 1qm4 (more details), 2.66 Å

PDB Description: methionine adenosyltransferase complexed with a l-methionine analogue

SCOP Domain Sequences for d1qm4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qm4b1 d.130.1.1 (B:17-116) S-adenosylmethionine synthetase {Rat (Rattus norvegicus)}
gafmftsesvgeghpdkicdqisdavldahlkqdpnakvacetvcktgmvllcgeitsma
midyqrvvrdtikhigyddsakgfdfktcnvlvaleqqsp

SCOP Domain Coordinates for d1qm4b1:

Click to download the PDB-style file with coordinates for d1qm4b1.
(The format of our PDB-style files is described here.)

Timeline for d1qm4b1: