Lineage for d3vz0c_ (3vz0 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909027Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2909028Protein automated matches [190683] (61 species)
    not a true protein
  7. 2909226Species Gluconobacter oxydans [TaxId:290633] [419884] (1 PDB entry)
  8. 2909229Domain d3vz0c_: 3vz0 C: [413514]
    automated match to d3rosa_
    complexed with 2pe

Details for d3vz0c_

PDB Entry: 3vz0 (more details), 2.3 Å

PDB Description: Structural insights into cofactor and substrate selection by Gox0499
PDB Compounds: (C:) Putative NAD-dependent aldehyde dehydrogenase

SCOPe Domain Sequences for d3vz0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vz0c_ c.82.1.0 (C:) automated matches {Gluconobacter oxydans [TaxId: 290633]}
mivyqtlnpttetversfdlhtpaqmkditdraehvwktdwklrsiaqrkeivsraadll
rrdrqhhasliatemgkalpdaleeidvtadilsfyangaeeflaptplkvktgqakiin
qplgiiyciepwnfpyyqlarvagpnlmagnvviakhapnvpqcalafeklfhdagapvg
ayanifldndqsaelikderirgvaltgseragqavaaqagaalkkdtmelggsdafivl
ddadldlavkwavwgrfanngqvctaakrmivhekvydafldglktaitrfrignpldrd
tthgpmsslramelaldqtaeavkggatlvaggkrmdrkgffmeptiltdvskdnpvfyq
eifgpvavvhkvaseqaaidlandspyglggavfsrdiaraekvaeqvetgmvfintata
aapelpfggiknsgfgrelsflgieefinrklvrig

SCOPe Domain Coordinates for d3vz0c_:

Click to download the PDB-style file with coordinates for d3vz0c_.
(The format of our PDB-style files is described here.)

Timeline for d3vz0c_:

  • d3vz0c_ is new in SCOPe 2.08-stable