Lineage for d3uqzb1 (3uqz B:1-71)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716782Superfamily a.60.17: SAM domain from DprA-like [418757] (1 family) (S)
  5. 2716783Family a.60.17.1: SAM domain from DprA-like [418833] (1 protein)
    Pfam PF18255
  6. 2716784Protein DNA processing protein A (DprA) [419156] (1 species)
  7. 2716785Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [419678] (1 PDB entry)
  8. 2716787Domain d3uqzb1: 3uqz B:1-71 [413490]
    Other proteins in same PDB: d3uqza2, d3uqza3, d3uqzb2, d3uqzc2
    automated match to d3uqza1
    complexed with so4

Details for d3uqzb1

PDB Entry: 3uqz (more details), 2.7 Å

PDB Description: X-ray structure of DNA processing protein A (DprA) from Streptococcus pneumoniae
PDB Compounds: (B:) DNA processing protein DprA

SCOPe Domain Sequences for d3uqzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uqzb1 a.60.17.1 (B:1-71) DNA processing protein A (DprA) {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mkitnyeiyklkksgltnqqilkvleygenvdqelllgdiadisgcrnpavfmeryfqid
dahlskefqkf

SCOPe Domain Coordinates for d3uqzb1:

Click to download the PDB-style file with coordinates for d3uqzb1.
(The format of our PDB-style files is described here.)

Timeline for d3uqzb1:

  • d3uqzb1 is new in SCOPe 2.08-stable