Lineage for d1fugb1 (1fug B:1-102)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1431743Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 1431744Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (1 family) (S)
  5. 1431745Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)
  6. 1431746Protein S-adenosylmethionine synthetase [55975] (3 species)
    synonym: methionine adenosyltransferase, MAT
  7. 1431747Species Escherichia coli [TaxId:562] [55976] (9 PDB entries)
  8. 1431793Domain d1fugb1: 1fug B:1-102 [41347]

Details for d1fugb1

PDB Entry: 1fug (more details), 3.2 Å

PDB Description: s-adenosylmethionine synthetase
PDB Compounds: (B:) s-adenosylmethionine synthetase

SCOPe Domain Sequences for d1fugb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fugb1 d.130.1.1 (B:1-102) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]}
akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdi

SCOPe Domain Coordinates for d1fugb1:

Click to download the PDB-style file with coordinates for d1fugb1.
(The format of our PDB-style files is described here.)

Timeline for d1fugb1: