Lineage for d1fugb1 (1fug B:1-102)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83986Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
  4. 83987Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (1 family) (S)
  5. 83988Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)
  6. 83989Protein S-adenosylmethionine synthetase [55975] (2 species)
  7. 83990Species Escherichia coli [TaxId:562] [55976] (7 PDB entries)
  8. 84012Domain d1fugb1: 1fug B:1-102 [41347]

Details for d1fugb1

PDB Entry: 1fug (more details), 3.2 Å

PDB Description: s-adenosylmethionine synthetase

SCOP Domain Sequences for d1fugb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fugb1 d.130.1.1 (B:1-102) S-adenosylmethionine synthetase {Escherichia coli}
akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdi

SCOP Domain Coordinates for d1fugb1:

Click to download the PDB-style file with coordinates for d1fugb1.
(The format of our PDB-style files is described here.)

Timeline for d1fugb1: