Lineage for d3tfyb_ (3tfy B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969076Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries)
  8. 2969171Domain d3tfyb_: 3tfy B: [413442]
    automated match to d6yzza_
    complexed with coa

Details for d3tfyb_

PDB Entry: 3tfy (more details), 2.75 Å

PDB Description: Naa50p amino-terminal acetyltransferase bound to substrate peptide fragment and CoA
PDB Compounds: (B:) N-alpha-acetyltransferase 50, NatE catalytic subunit

SCOPe Domain Sequences for d3tfyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tfyb_ d.108.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srielgdvtphnikqlkrlnqvifpvsyndkfykdvlevgelaklayfndiavgavccrv
dhsqnqkrlyimtlgclapyrrlgigtkmlnhvlnicekdgtfdniylhvqisnesaidf
yrkfgfeiietkknyykriepadahvlqknlk

SCOPe Domain Coordinates for d3tfyb_:

Click to download the PDB-style file with coordinates for d3tfyb_.
(The format of our PDB-style files is described here.)

Timeline for d3tfyb_:

  • d3tfyb_ is new in SCOPe 2.08-stable