Lineage for d1xraa3 (1xra A:232-383)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215558Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2215559Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2215560Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)
  6. 2215561Protein S-adenosylmethionine synthetase [55975] (3 species)
    synonym: methionine adenosyltransferase, MAT
  7. 2215562Species Escherichia coli [TaxId:562] [55976] (9 PDB entries)
  8. 2215604Domain d1xraa3: 1xra A:232-383 [41343]
    complexed with k, mg, po4

Details for d1xraa3

PDB Entry: 1xra (more details), 3 Å

PDB Description: crystal structure of s-adenosylmethionine synthetase
PDB Compounds: (A:) s-adenosylmethionine synthetase

SCOPe Domain Sequences for d1xraa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xraa3 d.130.1.1 (A:232-383) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]}
iggpmgdcgltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagla
drceiqvsyaigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiy
ketaayghfgrehfpwektdkaqllrdaaglk

SCOPe Domain Coordinates for d1xraa3:

Click to download the PDB-style file with coordinates for d1xraa3.
(The format of our PDB-style files is described here.)

Timeline for d1xraa3: