Lineage for d1xra_3 (1xra 232-383)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196717Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
  4. 196718Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (1 family) (S)
  5. 196719Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)
  6. 196720Protein S-adenosylmethionine synthetase [55975] (2 species)
  7. 196721Species Escherichia coli [TaxId:562] [55976] (7 PDB entries)
  8. 196739Domain d1xra_3: 1xra 232-383 [41343]

Details for d1xra_3

PDB Entry: 1xra (more details), 3 Å

PDB Description: crystal structure of s-adenosylmethionine synthetase

SCOP Domain Sequences for d1xra_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xra_3 d.130.1.1 (232-383) S-adenosylmethionine synthetase {Escherichia coli}
iggpmgdcgltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagla
drceiqvsyaigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiy
ketaayghfgrehfpwektdkaqllrdaaglk

SCOP Domain Coordinates for d1xra_3:

Click to download the PDB-style file with coordinates for d1xra_3.
(The format of our PDB-style files is described here.)

Timeline for d1xra_3: