Lineage for d1xra_3 (1xra 232-383)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (1 family) 
Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein) Protein S-adenosylmethionine synthetase [55975] (2 species) Species Escherichia coli [TaxId:562] [55976] (7 PDB entries) 
Domain d1xra_3: 1xra 232-383 [41343]
Details for d1xra_3
PDB Entry: 1xra (more details), 3 Å
PDB Description: crystal structure of s-adenosylmethionine synthetase
SCOP Domain Sequences for d1xra_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xra_3 d.130.1.1 (232-383) S-adenosylmethionine synthetase {Escherichia coli}
iggpmgdcgltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagla
drceiqvsyaigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiy
ketaayghfgrehfpwektdkaqllrdaaglk
SCOP Domain Coordinates for d1xra_3:
Click to download the PDB-style file with coordinates for d1xra_3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xra_3:
- d1xra_3 appears in SCOP 1.57
- d1xra_3 appears in the current release, SCOPe 2.08, called d1xraa3
View in 3D
