SCOPe 2.05: Domain d1xraa1: 1xra A:1-101

Lineage for d1xraa1 (1xra A:1-101)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)

6. Protein S-adenosylmethionine synthetase [55975] (3 species)
   synonym: methionine adenosyltransferase, MAT

7. Species Escherichia coli [TaxId:562] [55976] (9 PDB entries)

8. Domain d1xraa1: 1xra A:1-101 [41341]
   complexed with k, mg, po4

Details for d1xraa1

PDB Entry: 1xra, 3 Å

PDB Description: crystal structure of s-adenosylmethionine synthetase

PDB Compounds: (A:) s-adenosylmethionine synthetase

SCOPe Domain Sequences for d1xraa1:

Sequence; same for both SEQRES and ATOM records:

>d1xraa1 d.130.1.1 (A:1-101) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]}
akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspd

Timeline for d1xraa1:

• d1xraa1 first appeared (with stable ids) in SCOP 1.55, called d1xra_1
  
• d1xraa1 appears in SCOPe 2.04
  
• d1xraa1 appears in SCOPe 2.06
  
• d1xraa1 appears in the current release, SCOPe 2.08