Lineage for d1xrc_3 (1xrc 232-383)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 137596Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
  4. 137597Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (1 family) (S)
  5. 137598Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)
  6. 137599Protein S-adenosylmethionine synthetase [55975] (2 species)
  7. 137600Species Escherichia coli [TaxId:562] [55976] (7 PDB entries)
  8. 137615Domain d1xrc_3: 1xrc 232-383 [41340]

Details for d1xrc_3

PDB Entry: 1xrc (more details), 3 Å

PDB Description: crystal structure of s-adenosylmethionine synthetase

SCOP Domain Sequences for d1xrc_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrc_3 d.130.1.1 (232-383) S-adenosylmethionine synthetase {Escherichia coli}
iggpmgdcgltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagla
drceiqvsyaigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiy
ketaayghfgrehfpwektdkaqllrdaaglk

SCOP Domain Coordinates for d1xrc_3:

Click to download the PDB-style file with coordinates for d1xrc_3.
(The format of our PDB-style files is described here.)

Timeline for d1xrc_3: