Lineage for d3r1va_ (3r1v A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2711837Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2711930Family a.39.2.0: automated matches [191595] (1 protein)
    not a true family
  6. 2711931Protein automated matches [191085] (10 species)
    not a true protein
  7. 2711932Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [193461] (7 PDB entries)
  8. 2711948Domain d3r1va_: 3r1v A: [413383]
    automated match to d6hhea_
    complexed with azb

Details for d3r1va_

PDB Entry: 3r1v (more details), 2.19 Å

PDB Description: Odorant Binding Protein 7 from Anopheles gambiae with Four Disulfide Bridges, in complex with an azo compound
PDB Compounds: (A:) Odorant binding protein, antennal

SCOPe Domain Sequences for d3r1va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r1va_ a.39.2.0 (A:) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
feipdrykkpakmlheiciaesgaseeqlrtcldgtvptapaakcyihclfdkidvvdea
tgrilldrllyiipddvkaavdhltrecshivtpdkcetayetvkcyfnahdevikfchl
lvle

SCOPe Domain Coordinates for d3r1va_:

Click to download the PDB-style file with coordinates for d3r1va_.
(The format of our PDB-style files is described here.)

Timeline for d3r1va_:

  • d3r1va_ is new in SCOPe 2.08-stable