Lineage for d3r1pf_ (3r1p F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2711837Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2711930Family a.39.2.0: automated matches [191595] (1 protein)
    not a true family
  6. 2711931Protein automated matches [191085] (10 species)
    not a true protein
  7. 2711932Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [193461] (7 PDB entries)
  8. 2711940Domain d3r1pf_: 3r1p F: [413382]
    automated match to d6hhea_
    complexed with plm

Details for d3r1pf_

PDB Entry: 3r1p (more details), 1.85 Å

PDB Description: Odorant Binding Protein 7 from Anopheles gambiae with Four Disulfide Bridges, form P1
PDB Compounds: (F:) Odorant binding protein, antennal

SCOPe Domain Sequences for d3r1pf_:

Sequence, based on SEQRES records: (download)

>d3r1pf_ a.39.2.0 (F:) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
drykkpakmlheiciaesgaseeqlrtcldgtvptapaakcyihclfdkidvvdeatgri
lldrllyiipddvkaavdhltrecshivtpdkcetayetvkcyfnahdevikfchllvle

Sequence, based on observed residues (ATOM records): (download)

>d3r1pf_ a.39.2.0 (F:) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
drykkpakmlheiciaesgaseeqlrtcldgtvptapaakcyihclfdkidvvdeatgri
lldrllyiicshivtpdkcetayetvkcyfnahdevikfchllvle

SCOPe Domain Coordinates for d3r1pf_:

Click to download the PDB-style file with coordinates for d3r1pf_.
(The format of our PDB-style files is described here.)

Timeline for d3r1pf_:

  • d3r1pf_ is new in SCOPe 2.08-stable