Lineage for d1xrca1 (1xrc A:1-101)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. Family d.130.1.1: S-adenosylmethionine synthetase [55974] (2 proteins)
  6. Protein S-adenosylmethionine synthetase [55975] (3 species)
    synonym: methionine adenosyltransferase, MAT
  7. Species Escherichia coli [TaxId:562] [55976] (9 PDB entries)
  8. Domain d1xrca1: 1xrc A:1-101 [41338]
    complexed with co, k, po4

Details for d1xrca1

PDB Entry: 1xrc (more details), 3 Å

PDB Description: crystal structure of s-adenosylmethionine synthetase
PDB Compounds: (A:) s-adenosylmethionine synthetase

SCOPe Domain Sequences for d1xrca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrca1 d.130.1.1 (A:1-101) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]}
akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspd

SCOPe Domain Coordinates for d1xrca1 are not available.

Timeline for d1xrca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xrca2, d1xrca3