SCOPe 2.08: Domain d3q0ha1: 3q0h A:22-129

Lineage for d3q0ha1 (3q0h A:22-129)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3q0ha1: 3q0h A:22-129 [413361]
   Other proteins in same PDB: d3q0ha2
   automated match to d3udwa_

Details for d3q0ha1

PDB Entry: 3q0h, 1.7 Å

PDB Description: structure of t-cell immunoreceptor with immunoglobulin and itim domains (tigit)

PDB Compounds: (A:) T cell immunoreceptor with Ig and ITIM domains

SCOPe Domain Sequences for d3q0ha1:

Sequence; same for both SEQRES and ATOM records:

>d3q0ha1 b.1.1.0 (A:22-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mmtgtiettgnisaekggsiilqchlssttaqvtqvnweqqdqllaicnadlgwhispsf
kdrvapgpglgltlqsltvndtgeyfciyhtypdgtytgriflevles

Timeline for d3q0ha1:

• d3q0ha1 is new in SCOPe 2.08-stable