Lineage for d1mxc_3 (1mxc 232-383)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35862Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
  4. 35863Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (1 family) (S)
  5. 35864Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)
  6. 35865Protein S-adenosylmethionine synthetase [55975] (2 species)
  7. 35866Species Escherichia coli [TaxId:562] [55976] (7 PDB entries)
  8. 35875Domain d1mxc_3: 1mxc 232-383 [41334]

Details for d1mxc_3

PDB Entry: 1mxc (more details), 3 Å

PDB Description: s-adenosylmethionine synthetase with 8-br-adp

SCOP Domain Sequences for d1mxc_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mxc_3 d.130.1.1 (232-383) S-adenosylmethionine synthetase {Escherichia coli}
iggpmgdcgltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagla
drceiqvsyaigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiy
ketaayghfgrehfpwektdkaqllrdaaglk

SCOP Domain Coordinates for d1mxc_3:

Click to download the PDB-style file with coordinates for d1mxc_3.
(The format of our PDB-style files is described here.)

Timeline for d1mxc_3: