Lineage for d3pkma1 (3pkm A:8-128)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955800Superfamily d.58.53: Ferredoxin-like domains from CRISPR-associated proteins [117987] (8 families) (S)
  5. 2955828Family d.58.53.3: CRISPR-associated protein Cas6-like [418820] (1 protein)
    Pfam PF01881; duplication
  6. 2955829Protein CRISPR-associated protein Cas6 [419140] (1 species)
  7. 2955830Species Pyrococcus furiosus [TaxId:2261] [419662] (2 PDB entries)
  8. 2955833Domain d3pkma1: 3pkm A:8-128 [413336]
    Other proteins in same PDB: d3pkma3
    automated match to d3i4hx1
    protein/RNA complex

Details for d3pkma1

PDB Entry: 3pkm (more details), 3.1 Å

PDB Description: Crystal structure of Cas6 with its substrate RNA
PDB Compounds: (A:) Cas6 protein

SCOPe Domain Sequences for d3pkma1:

Sequence, based on SEQRES records: (download)

>d3pkma1 d.58.53.3 (A:8-128) CRISPR-associated protein Cas6 {Pyrococcus furiosus [TaxId: 2261]}
rflirlvpedkdrafkvpynhqyylqgliynaikssnpklatylhevkgpklftyslfma
ekrehpkglpyflgykkgffyfstcvpeiaealvngllmnpevrlwderfylheikvlre
p

Sequence, based on observed residues (ATOM records): (download)

>d3pkma1 d.58.53.3 (A:8-128) CRISPR-associated protein Cas6 {Pyrococcus furiosus [TaxId: 2261]}
rflirlvafkvpynhqyylqgliynaikssnpklatylhevkgpklftyslfmaekrehp
yflgykkgffyfstcvpeiaealvngllmnpevrlwderfylheikvlrep

SCOPe Domain Coordinates for d3pkma1:

Click to download the PDB-style file with coordinates for d3pkma1.
(The format of our PDB-style files is described here.)

Timeline for d3pkma1:

  • d3pkma1 is new in SCOPe 2.08-stable