Lineage for d1mxc_2 (1mxc 108-231)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196717Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
  4. 196718Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (1 family) (S)
  5. 196719Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)
  6. 196720Protein S-adenosylmethionine synthetase [55975] (2 species)
  7. 196721Species Escherichia coli [TaxId:562] [55976] (7 PDB entries)
  8. 196729Domain d1mxc_2: 1mxc 108-231 [41333]

Details for d1mxc_2

PDB Entry: 1mxc (more details), 3 Å

PDB Description: s-adenosylmethionine synthetase with 8-br-adp

SCOP Domain Sequences for d1mxc_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mxc_2 d.130.1.1 (108-231) S-adenosylmethionine synthetase {Escherichia coli}
radpleqgagdqglmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksq
vtfqyddgkivgidavvlstqhseeidqkslqeavmeeiikpilpaewltsatkffinpt
grfv

SCOP Domain Coordinates for d1mxc_2:

Click to download the PDB-style file with coordinates for d1mxc_2.
(The format of our PDB-style files is described here.)

Timeline for d1mxc_2: