Lineage for d1mxba3 (1mxb A:232-383)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582827Family d.130.1.1: S-adenosylmethionine synthetase [55974] (2 proteins)
  6. 2582828Protein S-adenosylmethionine synthetase [55975] (3 species)
    synonym: methionine adenosyltransferase, MAT
  7. 2582829Species Escherichia coli [TaxId:562] [55976] (9 PDB entries)
  8. 2582835Domain d1mxba3: 1mxb A:232-383 [41331]
    complexed with adp, k, mg, po4

Details for d1mxba3

PDB Entry: 1mxb (more details), 2.8 Å

PDB Description: s-adenosylmethionine synthetase with adp
PDB Compounds: (A:) s-adenosylmethionine synthetase

SCOPe Domain Sequences for d1mxba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mxba3 d.130.1.1 (A:232-383) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]}
iggpmgdcgltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagla
drceiqvsyaigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiy
ketaayghfgrehfpwektdkaqllrdaaglk

SCOPe Domain Coordinates for d1mxba3:

Click to download the PDB-style file with coordinates for d1mxba3.
(The format of our PDB-style files is described here.)

Timeline for d1mxba3: