Lineage for d3l82a_ (3l82 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734969Fold a.146: Telomeric repeat binding factor (TRF) dimerisation domain [63599] (1 superfamily)
    multihelical; can be divided into an alpha-alpha superhelix domain and a long alpha-hairpin dimerization domain
  4. 2734970Superfamily a.146.1: Telomeric repeat binding factor (TRF) dimerisation domain [63600] (1 family) (S)
    automatically mapped to Pfam PF08558
  5. 2734971Family a.146.1.1: Telomeric repeat binding factor (TRF) dimerisation domain [63601] (3 proteins)
  6. 2734972Protein TRF1 [63602] (1 species)
  7. 2734973Species Human (Homo sapiens) [TaxId:9606] [63603] (4 PDB entries)
  8. 2734975Domain d3l82a_: 3l82 A: [413306]
    automated match to d7c5da_
    protein/DNA complex

Details for d3l82a_

PDB Entry: 3l82 (more details), 2.4 Å

PDB Description: X-ray Crystal structure of TRF1 and Fbx4 complex
PDB Compounds: (A:) Telomeric repeat-binding factor 1

SCOPe Domain Sequences for d3l82a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l82a_ a.146.1.1 (A:) TRF1 {Human (Homo sapiens) [TaxId: 9606]}
aglvaeaeavaagwmldflclslcrafrdgrsedfrrtrnsaeaiihglssltacqlrti
yicqfltriaagktldaqfenderitplesalmiwgsiekehdklheeiqnlikiqaiav
cmengnfkeaeevferifgdpnshmpfkskllmiisqkdtfhsffqhfsynhmmekiksy
vnyvlseksstflmkaaakvves

SCOPe Domain Coordinates for d3l82a_:

Click to download the PDB-style file with coordinates for d3l82a_.
(The format of our PDB-style files is described here.)

Timeline for d3l82a_:

  • d3l82a_ is new in SCOPe 2.08-stable