Lineage for d1mxb_2 (1mxb 108-231)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 262283Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 262284Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (1 family) (S)
  5. 262285Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)
  6. 262286Protein S-adenosylmethionine synthetase [55975] (2 species)
    synonym: methionine adenosyltransferase, MAT
  7. 262287Species Escherichia coli [TaxId:562] [55976] (7 PDB entries)
  8. 262292Domain d1mxb_2: 1mxb 108-231 [41330]

Details for d1mxb_2

PDB Entry: 1mxb (more details), 2.8 Å

PDB Description: s-adenosylmethionine synthetase with adp

SCOP Domain Sequences for d1mxb_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mxb_2 d.130.1.1 (108-231) S-adenosylmethionine synthetase {Escherichia coli}
radpleqgagdqglmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksq
vtfqyddgkivgidavvlstqhseeidqkslqeavmeeiikpilpaewltsatkffinpt
grfv

SCOP Domain Coordinates for d1mxb_2:

Click to download the PDB-style file with coordinates for d1mxb_2.
(The format of our PDB-style files is described here.)

Timeline for d1mxb_2: