![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.10: Retroviral integrase, N-terminal Zn binding domain [46919] (3 families) ![]() |
![]() | Family a.4.10.2: Spumaviral integrase, N-terminal Zn binding domain [418801] (1 protein) includes N-terminal extention domain described in PubMed 20118915 Pfam PF17921 |
![]() | Protein Spumaviral integrase [419104] (1 species) |
![]() | Species Human spumaretrovirus [TaxID:11963] [419617] (3 PDB entries) |
![]() | Domain d3l2sa1: 3l2s A:10-106 [413296] Other proteins in same PDB: d3l2sa2, d3l2sa3 automated match to d3l2qa3 protein/DNA complex; complexed with gol, mn, nh4, zn |
PDB Entry: 3l2s (more details), 2.95 Å
SCOPe Domain Sequences for d3l2sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l2sa1 a.4.10.2 (A:10-106) Spumaviral integrase {Human spumaretrovirus [TaxID:11963]} aeldqllqghyikgypkqytyfledgkvkvsrpegvkiippqsdrqkivlqahnlahtgr eatllkianlywwpnmrkdvvkqlgrcqqclitnasn
Timeline for d3l2sa1: