Lineage for d3l2sa1 (3l2s A:10-106)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695622Superfamily a.4.10: Retroviral integrase, N-terminal Zn binding domain [46919] (3 families) (S)
  5. 2695664Family a.4.10.2: Spumaviral integrase, N-terminal Zn binding domain [418801] (1 protein)
    includes N-terminal extention domain described in PubMed 20118915
    Pfam PF17921
  6. 2695665Protein Spumaviral integrase [419104] (1 species)
  7. 2695666Species Human spumaretrovirus [TaxID:11963] [419617] (3 PDB entries)
  8. 2695667Domain d3l2sa1: 3l2s A:10-106 [413296]
    Other proteins in same PDB: d3l2sa2, d3l2sa3
    automated match to d3l2qa3
    protein/DNA complex; complexed with gol, mn, nh4, zn

Details for d3l2sa1

PDB Entry: 3l2s (more details), 2.95 Å

PDB Description: Crystal structure of the Prototype Foamy Virus (PFV) intasome in complex with manganese
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d3l2sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l2sa1 a.4.10.2 (A:10-106) Spumaviral integrase {Human spumaretrovirus [TaxID:11963]}
aeldqllqghyikgypkqytyfledgkvkvsrpegvkiippqsdrqkivlqahnlahtgr
eatllkianlywwpnmrkdvvkqlgrcqqclitnasn

SCOPe Domain Coordinates for d3l2sa1:

Click to download the PDB-style file with coordinates for d3l2sa1.
(The format of our PDB-style files is described here.)

Timeline for d3l2sa1:

  • d3l2sa1 is new in SCOPe 2.08-stable