Lineage for d3l1xa_ (3l1x A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037528Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 3037529Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 3037682Family g.44.1.0: automated matches [191345] (1 protein)
    not a true family
  6. 3037683Protein automated matches [190242] (4 species)
    not a true protein
  7. 3037688Species Human (Homo sapiens) [TaxId:9606] [189860] (17 PDB entries)
  8. 3037693Domain d3l1xa_: 3l1x A: [413292]
    automated match to d7c96b_

Details for d3l1xa_

PDB Entry: 3l1x (more details), 2.6 Å

PDB Description: Crystal Structure of U-box Domain of Human E4B Ubiquitin Ligase
PDB Compounds: (A:) Ubiquitin conjugation factor E4 B

SCOPe Domain Sequences for d3l1xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l1xa_ g.44.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdapdefrdplmdtlmtdpvrlpsgtimdrsiilrhllnsptdpfnrqtltesmlepvpe
lkeqiqawmrekqns

SCOPe Domain Coordinates for d3l1xa_:

Click to download the PDB-style file with coordinates for d3l1xa_.
(The format of our PDB-style files is described here.)

Timeline for d3l1xa_:

  • d3l1xa_ is new in SCOPe 2.08-stable