SCOPe 2.06: Domain d1mxba1: 1mxb A:1-102

Lineage for d1mxba1 (1mxb A:1-102)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)

6. Protein S-adenosylmethionine synthetase [55975] (3 species)
   synonym: methionine adenosyltransferase, MAT

7. Species Escherichia coli [TaxId:562] [55976] (9 PDB entries)

8. Domain d1mxba1: 1mxb A:1-102 [41329]
   complexed with adp, k, mg, po4

Details for d1mxba1

PDB Entry: 1mxb, 2.8 Å

PDB Description: s-adenosylmethionine synthetase with adp

PDB Compounds: (A:) s-adenosylmethionine synthetase

SCOPe Domain Sequences for d1mxba1:

Sequence; same for both SEQRES and ATOM records:

>d1mxba1 d.130.1.1 (A:1-102) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]}
akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdi

Timeline for d1mxba1:

• d1mxba1 first appeared (with stable ids) in SCOP 1.55, called d1mxb_1
  
• d1mxba1 appears in SCOPe 2.05
  
• d1mxba1 appears in SCOPe 2.07
  
• d1mxba1 appears in the current release, SCOPe 2.08