Lineage for d1mxb_1 (1mxb 1-102)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35862Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
  4. 35863Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (1 family) (S)
  5. 35864Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)
  6. 35865Protein S-adenosylmethionine synthetase [55975] (2 species)
  7. 35866Species Escherichia coli [TaxId:562] [55976] (7 PDB entries)
  8. 35870Domain d1mxb_1: 1mxb 1-102 [41329]

Details for d1mxb_1

PDB Entry: 1mxb (more details), 2.8 Å

PDB Description: s-adenosylmethionine synthetase with adp

SCOP Domain Sequences for d1mxb_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mxb_1 d.130.1.1 (1-102) S-adenosylmethionine synthetase {Escherichia coli}
akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdi

SCOP Domain Coordinates for d1mxb_1:

Click to download the PDB-style file with coordinates for d1mxb_1.
(The format of our PDB-style files is described here.)

Timeline for d1mxb_1: