Class a: All alpha proteins [46456] (290 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.0: automated matches [191534] (1 protein) not a true family |
Protein automated matches [190907] (21 species) not a true protein |
Species Silicibacter pomeroyi [TaxId:89184] [419858] (1 PDB entry) |
Domain d3kjxb1: 3kjx B:8-65 [413278] Other proteins in same PDB: d3kjxa2, d3kjxb2, d3kjxc2, d3kjxd2 automated match to d5ysza1 |
PDB Entry: 3kjx (more details), 2.33 Å
SCOPe Domain Sequences for d3kjxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kjxb1 a.35.1.0 (B:8-65) automated matches {Silicibacter pomeroyi [TaxId: 89184]} pltlrdvseasgvsemtvsrvlrnrgdvsdatrarvlaaakelgyvpnkiagalasnr
Timeline for d3kjxb1: