Lineage for d1mxa_1 (1mxa 1-102)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (1 family) 
Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein) Protein S-adenosylmethionine synthetase [55975] (2 species) Species Escherichia coli [TaxId:562] [55976] (7 PDB entries) 
Domain d1mxa_1: 1mxa 1-102 [41326]
Details for d1mxa_1
PDB Entry: 1mxa (more details), 2.8 Å
PDB Description: s-adenosylmethionine synthetase with ppi
SCOP Domain Sequences for d1mxa_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mxa_1 d.130.1.1 (1-102) S-adenosylmethionine synthetase {Escherichia coli}
akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdi
SCOP Domain Coordinates for d1mxa_1:
Click to download the PDB-style file with coordinates for d1mxa_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mxa_1:
- d1mxa_1 first appeared (with stable ids) in SCOP 1.55
- d1mxa_1 appears in SCOP 1.57
- d1mxa_1 appears in SCOP 1.61
- d1mxa_1 appears in the current release, SCOPe 2.08, called d1mxaa1
View in 3D
