SCOPe 2.06: Domain d1ndoe2: 1ndo E:155-445

Lineage for d1ndoe2 (1ndo E:155-445)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins)
   Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1

6. Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (5 species)

7. Species Pseudomonas putida [TaxId:303] [55971] (10 PDB entries)

8. Domain d1ndoe2: 1ndo E:155-445 [41325]
   Other proteins in same PDB: d1ndoa1, d1ndob_, d1ndoc1, d1ndod_, d1ndoe1, d1ndof_
   complexed with fe, fes

Details for d1ndoe2

PDB Entry: 1ndo, 2.25 Å

PDB Description: napthalene 1,2-dioxygenase

PDB Compounds: (E:) napthalene 1,2-dioxygenase

SCOPe Domain Sequences for d1ndoe2:

Sequence; same for both SEQRES and ATOM records:

>d1ndoe2 d.129.3.3 (E:155-445) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas putida [TaxId: 303]}
eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha
sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg
akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek
dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy
gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltk

Timeline for d1ndoe2:

• d1ndoe2 first appeared (with stable ids) in SCOP 1.55
  
• d1ndoe2 appears in SCOPe 2.05
  
• d1ndoe2 appears in SCOPe 2.07
  
• d1ndoe2 appears in the current release, SCOPe 2.08